PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5DL_0E369E1FC.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family YABBY
Protein Properties Length: 207aa    MW: 23749.9 Da    PI: 9.786
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5DL_0E369E1FC.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY174.85.6e-54113031170
                  YABBY  31 lfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvssekl.senedeevprvppvir 117
                            ++++vtvrCGhCtsllsvnl+   q  ++++h         +e+ k ++ +++ n+  + ++s+++  +++ +++++e++ ++ p   
  Traes_5DL_0E369E1FC.2   1 MLNIVTVRCGHCTSLLSVNLRGLIQSPPVQDH--------SQENFKAHNISFRGNYPDYGTSSKYRMPMMFsTKSDQEHMLHMRP--- 77 
                            579****************************9........7899999*********99999988887767734556667777655... PP

                  YABBY 118 PPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                             PekrqrvPsaynrfikeei+rik++nPdishreafs+aaknWahfP+ihfgl
  Traes_5DL_0E369E1FC.2  78 APEKRQRVPSAYNRFIKEEIRRIKTNNPDISHREAFSTAAKNWAHFPNIHFGL 130
                            6**************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046902.0E-521130IPR006780YABBY protein
SuperFamilySSF470951.31E-776124IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.105.4E-579124IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MLNIVTVRCG HCTSLLSVNL RGLIQSPPVQ DHSQENFKAH NISFRGNYPD YGTSSKYRMP  60
MMFSTKSDQE HMLHMRPAPE KRQRVPSAYN RFIKEEIRRI KTNNPDISHR EAFSTAAKNW  120
AHFPNIHFGL GSNESSKKLD EAIAAPTPQK VQEKFNKVYK SEGQNKSFQS WHKITQVFCS  180
GQCPISRLVT EFGYDDVRRC GNVVEDS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0995850.0EU099585.1 Triticum aestivum YABBY2 (YAB2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003561769.11e-100PREDICTED: protein YABBY 2
SwissprotQ10FZ74e-90YAB2_ORYSJ; Protein YABBY 2
TrEMBLW5FQB01e-158W5FQB0_WHEAT; Uncharacterized protein
STRINGMLOC_70676.21e-104(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP139437121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26580.22e-48YABBY family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]